PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009617842.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 258aa    MW: 30739.2 Da    PI: 7.3611
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009617842.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.31.7e-18449147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W ++Ed++l ++v+++G+++W++Ia++++ gR++k+c++rw++ 
   XP_009617842.1  4 RGHWRPQEDQKLRELVEKYGPHNWNAIAEKLQ-GRSGKSCRLRWFNQ 49
                     899*****************************.***********996 PP

2Myb_DNA-binding59.66.6e-195699146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     r+++T+eE+e+l+ a++ +G++ W+ Iar ++ gRt++ +k++w+ 
   XP_009617842.1 56 RNPFTEEEEERLLSAHRIHGNR-WAIIARLFP-GRTDNAVKNHWHV 99
                     789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.699150IPR017930Myb domain
SMARTSM007173.7E-16352IPR001005SANT/Myb domain
PfamPF002491.6E-18449IPR001005SANT/Myb domain
SuperFamilySSF466891.54E-30497IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-27557IPR009057Homeodomain-like
CDDcd001676.77E-14748No hitNo description
PROSITE profilePS5129426.84551105IPR017930Myb domain
SMARTSM007172.8E-1655103IPR001005SANT/Myb domain
PfamPF002495.4E-165698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2158104IPR009057Homeodomain-like
CDDcd001671.30E-115898No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MCSRGHWRPQ EDQKLRELVE KYGPHNWNAI AEKLQGRSGK SCRLRWFNQL DPRINRNPFT  60
EEEEERLLSA HRIHGNRWAI IARLFPGRTD NAVKNHWHVI MARKCRERSK IYTKRAVAAA  120
YKKSMSNEKE SSSSRPQDNY MQISNEIMIT RRFNRFVDDQ QFSERFAYPN LIYNYSFYPK  180
LLHNDYLFHH AKMDQVLCTD ENQPTEFYDF LQVNTDSNKS EVIDHTSRIR DDEESEQEDV  240
DLHQSAQFID FLSVGDSA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-3541057108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009617842.10.0PREDICTED: transcriptional activator Myb-like
TrEMBLA0A067DID91e-103A0A067DID9_CITSI; Uncharacterized protein
TrEMBLV4VNT61e-103V4VNT6_9R
STRINGPOPTR_0015s05130.11e-98(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.15e-85myb domain protein 52